PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK13108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 610aa    MW: 67137.6 Da    PI: 5.2756
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK13108.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3534.6e-1082426103374
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                ++L++cA+  +  + e+a + L +l+e +s++gdp++R++++f+eAL +r++   ++ ++a+  s++s    ++ +  +k++++++P+ kf+hltaNqaI
  PK13108.1 242 KALIDCARLTE-AEPERAVKSLIKLKESVSEQGDPTERVTFHFAEALYNRVSLPAEKSCSAIYESASS----EDFTLPYKALNDACPYSKFAHLTANQAI 336
                79******655.58889999999******************************888888888877775....7899999********************* PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                lea+e+++++Hi+Df+i qG+QW+aLlqaLa+Rp g+p ++R+ g+ + + g   + +l +tg+rL++fA+ l+++f f++ +   +++l+ +++rv+++
  PK13108.1 337 LEATERASKIHIVDFGIVQGVQWAALLQALATRPTGKPtKIRLSGIPALALGrtPAASLVATGNRLSEFAKLLELNFVFEP-ILIPISELNESSFRVEED 435
                **********************************66666*********99889999*************************.6889************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                E+laVn++lql++llde+    +   + L+l ksl+Pk+v++ e ea++n+  F++rf +al+yy+a+f+sle +l+res er  vEr+l+gr+i  vv 
  PK13108.1 436 EVLAVNFMLQLYNLLDETPMAVH---TALRLAKSLNPKIVTLGEYEASLNQVGFMTRFKNALKYYTAVFESLEPNLSRESPERLQVERVLFGRRIGCVVG 532
                ***************99988888...9************************************************************************* PP

       GRAS 300 cegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                 e  + +rer+e  ++W++ +e + F+pv+ls++a++qak ll +++ s  +++ e+s +++ l W+d pL++vS+Wr
  PK13108.1 533 PEDPRtKRERMEDRKEWKALMEGCEFQPVKLSHYAVSQAKILLWNYNySSLFSLVESSPAFLsLAWNDVPLLTVSSWR 610
                9998779****************************************9999*******99999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.36214588IPR005202Transcription factor GRAS
PfamPF035141.6E-105242610IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MAIAQQVIKQ KQQQEQQQQQ SHQQQQLTGL SPFSLNPWST VTHHNTMSNA PNLGGYGLAG  60
SGFPDPFLVT GGSDTGEPGF QFPHMDHHST GFRFSDFGAG PGGEFESDEW MDSIMGGGDS  120
TDSSNLPSGC DAWQNNAADF VLYGAADPFA ACPSRLSIPS SSSPSDLNRV NLFNETQQKN  180
PNPLQQTQVS PWIPPQAPQS PPVVSKDSKS TNPPPSHSVR KNDVIGVSTS SPEIESAPPL  240
FKALIDCARL TEAEPERAVK SLIKLKESVS EQGDPTERVT FHFAEALYNR VSLPAEKSCS  300
AIYESASSED FTLPYKALND ACPYSKFAHL TANQAILEAT ERASKIHIVD FGIVQGVQWA  360
ALLQALATRP TGKPTKIRLS GIPALALGRT PAASLVATGN RLSEFAKLLE LNFVFEPILI  420
PISELNESSF RVEEDEVLAV NFMLQLYNLL DETPMAVHTA LRLAKSLNPK IVTLGEYEAS  480
LNQVGFMTRF KNALKYYTAV FESLEPNLSR ESPERLQVER VLFGRRIGCV VGPEDPRTKR  540
ERMEDRKEWK ALMEGCEFQP VKLSHYAVSQ AKILLWNYNY SSLFSLVESS PAFLSLAWND  600
VPLLTVSSWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1472396103375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113493.10.0hypothetical protein L484_026828
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLW9T1870.0W9T187_9R
STRINGPGSC0003DMT4000385730.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62803449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein